Transcript | Ll_transcript_273961 |
---|---|
CDS coordinates | 835-1599 (+) |
Peptide sequence | MDLFYISNYILRIFQLGTSFKFHLQDSIDLGQNDRPSFGTLDFTSSIVRGRFSVDSDVGPERANVPIRTSIGDGSRVSVSSIGYASSVASGPDDFESLGDVYIWGKVWTDGISSDGLGSQVPSKIDVLAPKALESNVVIDVYQIASGVRHIALVTRQGEVFTWGEESGGRLGHGSDKDFCQPHLVESLAMTSVSFVSCGEFHTCAVSTSGDLYTWGDGTHNVGLLGHGTNVSHWIPKRVSGPLEGLKVVSLACGS |
ORF Type | 3prime_partial |
Blastp | PH, RCC1 and FYVE domains-containing protein 1 from Arabidopsis with 61.17% of identity |
---|---|
Blastx | PH, RCC1 and FYVE domains-containing protein 1 from Arabidopsis with 61.17% of identity |
Eggnog | regulator of chromosome condensation(COG5184) |
Kegg | Link to kegg annotations (AT1G76950) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019431959.1) |
Pfam | Regulator of chromosome condensation (RCC1) repeat (PF00415.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer