Transcript | Ll_transcript_272953 |
---|---|
CDS coordinates | 686-1201 (+) |
Peptide sequence | MQGGPDYIVLKSLDTDGIRIIGSVLGQSIALDYFVSQVDRLVEEFAGINRGMEKTGTFTMDKKKLLQLVGKANSHLADVILKVGLFERSEIAWRDAKYAQIYEYLQEEYEVAQRFGNLDFKLKFVEHNIHFLQEVLQNRKSDFLEWCIICLLSIENVISFYEILHQSNTIS* |
ORF Type | complete |
Blastp | Sporulation protein RMD1 from Saccharomyces with 23.12% of identity |
---|---|
Blastx | Sporulation protein RMD1 from Saccharomyces with 23.12% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (YDL001W) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019429716.1) |
Pfam | Uncharacterised ACR, YagE family COG1723 (PF02582.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer