Protein coding transcript 178838

• Transcript: Ll_transcript_272819
• CDS coordinates: 382-702 (+)
• Peptide sequence: MGFVFTVGIFGILILFHAAYSTIQYRGLLKITEEEFSGPPFDVLIELFLGLVICIWAALTLPAKFLSIHPHSEDNRVVSLSANVDFMIFNHRGKVFPVATDLKLRQ*
• ORF Type: complete

Annotations of Ll_transcript_272819

• Blastp: Membrane magnesium transporter from Arabidopsis with 66.99% of identity
• Blastx: Membrane magnesium transporter from Arabidopsis with 66.99% of identity
• Eggnog: Membrane magnesium transporter(ENOG4111UG5)
• Kegg: Link to kegg annotations (AT5G03345)
• CantataDB: Link to cantataDB annotations (CNT0001584)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424837.1)
• Pfam: Membrane magnesium transporter (PF10270.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;