Transcript | Ll_transcript_389588 |
---|---|
CDS coordinates | 155-559 (+) |
Peptide sequence | MALHKNVYTFEEVSKHNKTEDCWVIISGKVYDLTSFIEDHPGGAEVILAATGKDGTSDYDAAGHSDYAIEMMEKYFIGKIDTTNVPQTRKYTPPEQDQYSASMSTEFVIKFLQYLFPILMLGLAFAVRYYTRKE* |
ORF Type | complete |
Blastp | Cytochrome b5 isoform E from Arabidopsis with 59.7% of identity |
---|---|
Blastx | Cytochrome b5 isoform E from Arabidopsis with 59.7% of identity |
Eggnog | cytochrome b5(COG5274) |
Kegg | Link to kegg annotations (AT5G53560) |
CantataDB | Link to cantataDB annotations (CNT0002027) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019414922.1) |
Pfam | Cytochrome b5-like Heme/Steroid binding domain (PF00173.27) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer