Protein coding transcript 1789

• Transcript: Ll_transcript_389588
• CDS coordinates: 155-559 (+)
• Peptide sequence: MALHKNVYTFEEVSKHNKTEDCWVIISGKVYDLTSFIEDHPGGAEVILAATGKDGTSDYDAAGHSDYAIEMMEKYFIGKIDTTNVPQTRKYTPPEQDQYSASMSTEFVIKFLQYLFPILMLGLAFAVRYYTRKE*
• ORF Type: complete

Annotations of Ll_transcript_389588

• Blastp: Cytochrome b5 isoform E from Arabidopsis with 59.7% of identity
• Blastx: Cytochrome b5 isoform E from Arabidopsis with 59.7% of identity
• Eggnog: cytochrome b5(COG5274)
• Kegg: Link to kegg annotations (AT5G53560)
• CantataDB: Link to cantataDB annotations (CNT0002027)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414922.1)
• Pfam: Cytochrome b5-like Heme/Steroid binding domain (PF00173.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;