Protein coding transcript 178940

• Transcript: Ll_transcript_273309
• CDS coordinates: 265-1083 (+)
• Peptide sequence: MDRVFSVGEIADHFWSPAIPSSLSSGAADESSKMNRSASEWAFQRFLQEATSVTSPPSSSSVADRNDDVVLVETNSHQSKLDRAQSVDTTLLQKNDAVLHNGPSVPPPGSVGSEEYQAFLKSKLNLACAAVAIARGSLIKSQDQATFPDSGSQLLSNLSQPGPQPTFTGSGPSGSDPPKLQEKDAKVPVGIPSIPAMQKKPAVAIRPSTSGSSRELSDDEDMEGETDMNDNMDPADVKRVRRMLSNRESARRSRRRKQAHLTDLETQVNQLRG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_273309

• Blastp: Light-inducible protein CPRF2 from Petroselinum with 48.01% of identity
• Blastx: Light-inducible protein CPRF2 from Petroselinum with 46.89% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428540.1)
• Pfam: bZIP transcription factor (PF00170.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;