| Transcript | Ll_transcript_273325 |
|---|---|
| CDS coordinates | 3384-3791 (+) |
| Peptide sequence | MAEETVKRITGLNPMFHAMSDISTMNMPSFDGSPSDTSADAAVPVHDNNPNHHFYQQPTSNNPIPNHDMRVINNGLGDIPSSIENVQQNAAAAVTGGSKIGQPASLNRVASLEHLQKRIRGGVDSTGPSSNGEQH* |
| ORF Type | complete |
| Blastp | Light-inducible protein CPRF2 from Petroselinum with 51.85% of identity |
|---|---|
| Blastx | Light-inducible protein CPRF2 from Petroselinum with 52.55% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019428540.1) |
| Pfam | Basic leucine-zipper C terminal (PF12498.7) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer