Protein coding transcript 178952

• Transcript: Ll_transcript_274232
• CDS coordinates: 491-1132 (+)
• Peptide sequence: MGGCCCCSSKETQLNAPPRSPYYYYPRLSEEHVPLSSHHNAASGFSGGLLVDTNLDTSSPDTYRPPPAPIPFNVTFGVTQTPPAAQEICVDKTDASLHPANSDSNQETVTGDNHGASAKPDELKESDCNVQTALELDSAKDSEVQLPKLAEPVSFVEEEDTCPICLEEYDAENPKLLTKCDHHFHLACILEWMERSETCPVCDQDMVLDLPLD*
• ORF Type: complete

Annotations of Ll_transcript_274232

• Blastp: Probable E3 ubiquitin-protein ligase RHB1A from Arabidopsis with 40.19% of identity
• Blastx: Probable E3 ubiquitin-protein ligase RHB1A from Arabidopsis with 38.65% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT4G00335)
• CantataDB: Link to cantataDB annotations (CNT0000117)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423305.1)
• Pfam: RING-H2 zinc finger domain (PF12678.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;