Protein coding transcript 178953

• Transcript: Ll_transcript_274233
• CDS coordinates: 291-842 (+)
• Peptide sequence: MGGCCCCSSKETQLNAPPRSPYYYYPRLSEEHVPLSSHHNAASGFSGGLLVDTNLDTSSPDTYRPPPAPIPFNVTFGVTQTPPAAQEICVDKTDASLHPANSDSNQETVTGDNHGASAKPDELKESDCNVQTALELDSAKDSEVQLPKLAEPVSFVEEEDTCPICLEGDILMSSVFSFISFHH*
• ORF Type: complete

Annotations of Ll_transcript_274233

• Blastp: Probable E3 ubiquitin-protein ligase RHB1A from Arabidopsis with 34.73% of identity
• Blastx: Probable E3 ubiquitin-protein ligase RHB1A from Arabidopsis with 32.93% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT4G00335)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423305.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;