| Transcript | Ll_transcript_274382 |
|---|---|
| CDS coordinates | 2192-2539 (+) |
| Peptide sequence | MGFLRDPCAFLRVLQSVLNTTGYRFILFTAGYEPLESTVHMIAAEASIDHSMRNEDCVHLYDGRLFCFSGSIPYGWLFPKCAAVIHHGGSGTTAAALQAGTPQVSGESNLANMYA* |
| ORF Type | complete |
| Blastp | Sterol 3-beta-glucosyltransferase from Debaryomyces with 63.89% of identity |
|---|---|
| Blastx | Sterol 3-beta-glucosyltransferase from Debaryomyces with 63.89% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (DEHA2E23738g) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019418459.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer