Protein coding transcript 17917

• Transcript: Ll_transcript_356098
• CDS coordinates: 2709-3185 (+)
• Peptide sequence: MLVIDTWQYFMHRYMHHNKFLYKHIHSQHHRLIVPYSFGALYNHPLEGLILDTIGGALSFLISGMSPRISIFFFSFATIKTVDDHCGLWLPGNLFHIFFNNNSAYHDVHHQLFGNKYNYSQPFFVMWDKILGTYMPYTLEKKAGGGFETRPCKDHKDD*
• ORF Type: complete

Annotations of Ll_transcript_356098

• Blastp: Sphinganine C4-monooxygenase 1 from Arabidopsis with 84.18% of identity
• Blastx: Sphinganine C4-monooxygenase 2 from Arabidopsis with 79.79% of identity
• Eggnog: fatty acid hydroxylase(COG3000)
• Kegg: Link to kegg annotations (AT1G69640)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433403.1)
• Pfam: Fatty acid hydroxylase superfamily (PF04116.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;