| Transcript | Ll_transcript_356084 |
|---|---|
| CDS coordinates | 519-899 (+) |
| Peptide sequence | MAHLGSTQVDTGFGDDDIYTQLWKLCAGPLVNVPHVEERVYYFPQGHMEQLQASTNQELNQQIPHFNLPSKILCRVMHTQLLVLMFLLCFCCPYLFINIMVMIMSMTIVCICILFLSYVFFVKFVG* |
| ORF Type | complete |
| Blastp | Auxin response factor 11 from Arabidopsis with 65.75% of identity |
|---|---|
| Blastx | Auxin response factor 11 from Arabidopsis with 70.15% of identity |
| Eggnog | auxin response factor(ENOG410YECH) |
| Kegg | Link to kegg annotations (AT2G46530) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019424247.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer