Protein coding transcript 17919

• Transcript: Ll_transcript_356085
• CDS coordinates: 519-959 (+)
• Peptide sequence: MAHLGSTQVDTGFGDDDIYTQLWKLCAGPLVNVPHVEERVYYFPQGHMEQLQASTNQELNQQIPHFNLPSKILCRVMHTQLLAEQETDEVYARITLLPESDQNEPISPNPCPPETQKHTFHSFSEILTASDTSTHGGFSVKLQPKS*
• ORF Type: complete

Annotations of Ll_transcript_356085

• Blastp: Auxin response factor 11 from Arabidopsis with 67.69% of identity
• Blastx: Auxin response factor 11 from Arabidopsis with 67.69% of identity
• Eggnog: auxin response factor(ENOG410YECH)
• Kegg: Link to kegg annotations (AT2G46530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424247.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;