Transcript | Ll_transcript_356088 |
---|---|
CDS coordinates | 2560-3036 (+) |
Peptide sequence | MLVMDTWQYFMHRYMHHNKFLYKHIHSRHHRLIVPYSFGAMYNHPVEGLLLDTIGGALSFLISGMSPRASIFFFSFATMKTVDDHCGLWLPGNLFHIFFNNNSAYHDIHHQLYGNKYNYSQPFFVMWDRILGTYMPYTLDKKSGGGFETRPCTDQKDD* |
ORF Type | complete |
Blastp | Sphinganine C4-monooxygenase 1 from Arabidopsis with 84.18% of identity |
---|---|
Blastx | Sphinganine C4-monooxygenase 1 from Arabidopsis with 79.89% of identity |
Eggnog | fatty acid hydroxylase(COG3000) |
Kegg | Link to kegg annotations (AT1G69640) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019455661.1) |
Pfam | Fatty acid hydroxylase superfamily (PF04116.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer