Protein coding transcript 17923

• Transcript: Ll_transcript_356090
• CDS coordinates: 133-447 (+)
• Peptide sequence: MVLLFFLFVLFCVLQLQASTNQELNQQIPHFNLPSKILCRVMHTQLLAEQENEVYARITLLPESDQNEPVSPNPCPPETQKQIFHSFRKILTASDTSTHGGFSVL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_356090

• Blastp: Auxin response factor 7 from Oryza sativa with 59.22% of identity
• Blastx: Auxin response factor 7 from Oryza sativa with 64.04% of identity
• Eggnog: auxin response factor(ENOG410Y8ZK)
• Kegg: Link to kegg annotations (4329672)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424263.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;