Protein coding transcript 179232

• Transcript: Ll_transcript_273262
• CDS coordinates: 161-778 (+)
• Peptide sequence: MEIGWEMEKSVRELREYFKTGKTRSVTWRKNQLRGILDLVHDNENAMFDALYHDLGKHPVEAYRDEIGGVEKSANNSLSCVEKWMVPKKSSIPLFFFPAKGEVLSEPLGVVLIFSSWNFPIMLALDPLIGAIAAGNVVVIKPSDQAPKCSNFLANIIPQYLDSNAVKVIEGGPNVCEQLLLQKWDKIFFTGIVLHNKNIYYYIKT*
• ORF Type: complete

Annotations of Ll_transcript_273262

• Blastp: Aldehyde dehydrogenase family 3 member F1 from Arabidopsis with 58.38% of identity
• Blastx: Aldehyde dehydrogenase family 3 member F1 from Arabidopsis with 58.38% of identity
• Eggnog: Dehydrogenase(COG1012)
• Kegg: Link to kegg annotations (AT4G36250)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446870.1)
• Pfam: Aldehyde dehydrogenase family (PF00171.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;