Protein coding transcript 17924

• Transcript: Ll_transcript_356093
• CDS coordinates: 377-814 (+)
• Peptide sequence: MAHPGSTQVDTGFGDDNIYTQLWKLCAGPLVNVPHAEERVYYFPQGHMEQLQASTNQELNQQIPHFNLPSKILCRVMHTQLLAEQENEVYARITLLPESDQNEPISPNPCPPETQKHTFHSFSEILTASDTSTHGGFSVKLQPKS*
• ORF Type: complete

Annotations of Ll_transcript_356093

• Blastp: Auxin response factor 18 from Arabidopsis with 61.11% of identity
• Blastx: Auxin response factor 9 from Arabidopsis with 64.34% of identity
• Eggnog: auxin response factor(ENOG410YECH)
• Kegg: Link to kegg annotations (AT3G61830)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424247.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;