Protein coding transcript 179279

• Transcript: Ll_transcript_273626
• CDS coordinates: 155-1273 (+)
• Peptide sequence: MASRPIVPFQQKAKGEEVVGGRKQQKNAAGDGKNRKALGDIGNLDHVKGVEIKPNRPITRSFCAQLLANAQAAAAAKNNKKLAIPNVADPKPNVADGVVAKRVAPKPAEKKVTAKPKAQEVIEINPAEEAQKNKSVNKKKEGGENKKKSRTLTSVLTARSKAACGLTNKPKEKIIDIDAGDSGNELAAVEYIEDIYKFYKLAENENRPHQYMDSQPDINEKMRAILVDWLINVHTKFDLSLETLYLTINIIDRFLALKTVPRKELQLVGISAMLMASKYEEIWPPEVDEFVCLSDRAFIHEEVLAMEKIILGKLEWTLTVPTPYVFLVRFIKASVPDQELENMAHFLSELGMMHYGTLMYCPSMIAASAVFAA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_273626

• Blastp: G2/mitotic-specific cyclin S13-6 from Soja with 74.6% of identity
• Blastx: G2/mitotic-specific cyclin S13-6 from Soja with 73.54% of identity
• Eggnog: g2 mitotic-specific(COG5024)
• Kegg: Link to kegg annotations (547920)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433323.1)
• Pfam: Cyclin, N-terminal domain (PF00134.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;