Transcript | Ll_transcript_273203 |
---|---|
CDS coordinates | 530-1519 (+) |
Peptide sequence | MDSRQKGALMNNKSVEDISVVELQQYKNQRKTNSSPEETVNQSRCLICTGKNSCETVHSRTKLMNTLIGKGKPHEAQAIFNSLTEEGHRPTLITYTTLVAALTRQKRFKSIPSLLSKVEENGMKPDSILFNAIINAFSDSGKVDEAMKIFQKMKEYGCKPTTSTFNTLIKGFGLAGRPYESMKLLEMMGQEEKVKPNERTYNILIQAFCTTKKLEETWSILHKMVASGLRPDVVTYNTLARAYAQNGETEKAERLILKMQYNKLKPNERTCGIIISGYCKERNMTDALRFLYKMKELGVHPNPVVFNSLIKGYLDTTDTDGVDEVSSNT* |
ORF Type | complete |
Blastp | Pentatricopeptide repeat-containing protein At5g21222 from Arabidopsis with 63.83% of identity |
---|---|
Blastx | Pentatricopeptide repeat-containing protein At5g21222 from Arabidopsis with 63.83% of identity |
Eggnog | Pentatricopeptide repeat-containing protein(ENOG410Z7Z7) |
Kegg | Link to kegg annotations (AT5G21222) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446333.1) |
Pfam | Pentatricopeptide repeat domain (PF13812.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer