Protein coding transcript 179443

• Transcript: Ll_transcript_274440
• CDS coordinates: 3-392 (-)
• Peptide sequence: MSSSWWAGNVAMKQTEPNSSSPPLQLRNQTEEEQVELIRVKPRQEQEFMNKNNGNNNLATLTNSTNSNNNSTEDDENNNYGDDNNNHGTPYQGRRRPRGRPPGSRNKLKPPVVITKESPNALRSHVLEIS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_274440

• Blastp: AT-hook motif nuclear-localized protein 29 from Arabidopsis with 54.84% of identity
• Blastx: AT-hook motif nuclear-localized protein 27 from Arabidopsis with 70.37% of identity
• Eggnog: DNA binding(ENOG410YHN4)
• Kegg: Link to kegg annotations (AT1G76500)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461024.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;