Protein coding transcript 179521

• Transcript: Ll_transcript_274615
• CDS coordinates: 520-969 (+)
• Peptide sequence: MSFGGFLDNNFGGGSARNLSDIPHSKGTTTNQNNNNRIMPSGAISHHSLMTPTLAKPMFNSPGLSLALQTNIDGQGEHLNRSMGENNNFEVNGLRRSREEEHESRSGSDNMDGASGDDEQDAADNPPRKKRYHRHTPQQIQERESLFKEC
• ORF Type: 3prime_partial

Annotations of Ll_transcript_274615

• Blastp: Homeobox-leucine zipper protein ANTHOCYANINLESS 2 from Arabidopsis with 50.62% of identity
• Blastx: Homeobox-leucine zipper protein ANTHOCYANINLESS 2 from Arabidopsis with 50.34% of identity
• Eggnog: Homeobox-leucine zipper protein(ENOG411107H)
• Kegg: Link to kegg annotations (AT4G00730)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456357.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;