Protein coding transcript 1796

• Transcript: Ll_transcript_389637
• CDS coordinates: 3-854 (+)
• Peptide sequence: REPLDATAVAEAVSVISCWYEDKTEWGDRVGWIYGSVTEDVVTGYRMHNRGWRSVYCVTKRDAFRGSAPINLTDRLHQVLRWATGSVEIFFSQNNAFLASRKLKFLQRISYLNVGIYPFTSIFLVVYCFLPALSLFSGYFIVQTLSVAFLVYLLTITICLVLLAILEVKWSGVELEQWWRNEQFWLISGTSAHLAAVVQGLLKVIAGIEISFTLTTKSSSEEEEDIYADLYIVKWSSLMIPPIVIAMVNIIAIVFAFIKTIYSTTAQWSKFIGGAFFSFWVLVH
• ORF Type: internal

Annotations of Ll_transcript_389637

• Blastp: Cellulose synthase-like protein D3 from Oryza sativa with 84.15% of identity
• Blastx: Cellulose synthase-like protein D4 from Arabidopsis with 84.86% of identity
• Eggnog: Glycosyl transferase, family 2(COG1215)
• Kegg: Link to kegg annotations (9271833)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459321.1)
• Pfam: Cellulose synthase (PF03552.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;