Protein coding transcript 179695

• Transcript: Ll_transcript_273589
• CDS coordinates: 1031-1570 (+)
• Peptide sequence: MVNFLWVIRKAEWTLPDGFEERVEKRGIVVREWVDQREILMHESVEGFLSHCGWNSVLESICAGVPILAWPMMAEQHLNARMVDEEIKIGLRVETSDGSVRGFVKCEGLRKSVKELMEGEKGREGRKKVMKLADIAKNAVQEGGSSCSTLNLLFQEICTHHNELAPMSNSETTPSNNNI*
• ORF Type: complete

Annotations of Ll_transcript_273589

• Blastp: UDP-glycosyltransferase 90A1 from Arabidopsis with 61.01% of identity
• Blastx: UDP-glycosyltransferase 90A1 from Arabidopsis with 61.27% of identity
• Eggnog: Transferase(COG1819)
• Kegg: Link to kegg annotations (AT2G16890)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429574.1)
• Pfam: UDP-glucoronosyl and UDP-glucosyl transferase (PF00201.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;