Protein coding transcript 179713

• Transcript: Ll_transcript_274320
• CDS coordinates: 122-985 (+)
• Peptide sequence: MTLKMTKFFQIFFLCIISLTCLSFAMPRNEYSILHHNHLNKFSSSEEGVFQLFKLWQKEHGRQYGNPEEESSRLEIFQKNLLYINEKNAKRKSQLQHHLGLNKFADMSPQEFKKSYLLHEIEKPSKWGNRKVHDDDSCENLPDSVDWREKGAVTEVRDQGNCQSHWAFSVTGAIEGLNKIITDKLIPLSVQELVDCDPASKGCAGGYYFNAFGYVIQNGGIDTEADYPYTAKNGTCKVYGLFFSQHAYLQNGTCSQESNPSPWDVESLNEIFLVSYYLIYGLFVNLC*
• ORF Type: complete

Annotations of Ll_transcript_274320

• Blastp: P34 probable thiol protease from Soja with 49.75% of identity
• Blastx: P34 probable thiol protease from Soja with 49.75% of identity
• Eggnog: cathepsin(COG4870)
• Kegg: Link to kegg annotations (548062)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440324.1)
• Pfam: Cathepsin propeptide inhibitor domain (I29) (PF08246.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;