Transcript | Ll_transcript_274320 |
---|---|
CDS coordinates | 122-985 (+) |
Peptide sequence | MTLKMTKFFQIFFLCIISLTCLSFAMPRNEYSILHHNHLNKFSSSEEGVFQLFKLWQKEHGRQYGNPEEESSRLEIFQKNLLYINEKNAKRKSQLQHHLGLNKFADMSPQEFKKSYLLHEIEKPSKWGNRKVHDDDSCENLPDSVDWREKGAVTEVRDQGNCQSHWAFSVTGAIEGLNKIITDKLIPLSVQELVDCDPASKGCAGGYYFNAFGYVIQNGGIDTEADYPYTAKNGTCKVYGLFFSQHAYLQNGTCSQESNPSPWDVESLNEIFLVSYYLIYGLFVNLC* |
ORF Type | complete |
Blastp | P34 probable thiol protease from Soja with 49.75% of identity |
---|---|
Blastx | P34 probable thiol protease from Soja with 49.75% of identity |
Eggnog | cathepsin(COG4870) |
Kegg | Link to kegg annotations (548062) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440324.1) |
Pfam | Cathepsin propeptide inhibitor domain (I29) (PF08246.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer