Protein coding transcript 179827

• Transcript: Ll_transcript_196420
• CDS coordinates: 386-820 (+)
• Peptide sequence: MSSYYWHGRDNRTMLELNPKTLSSGLDDYPRASHPNGDERHLDLRFWMLLAADCMRSIEELLNKETKPEKDYAFTAKLLSDLELLNQMHFDDAYGAYFDFGNHTEKVQLKWKEVEAVHGHASRKLVRDVVERPDLRLVPHIGYVS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_196420

• Blastp: Mannosyl-oligosaccharide glucosidase GCS1 from Arabidopsis with 69.18% of identity
• Blastx: Mannosyl-oligosaccharide glucosidase GCS1 from Arabidopsis with 64.4% of identity
• Eggnog: mannosyloligosaccharide glucosidase(ENOG410XTHA)
• Kegg: Link to kegg annotations (AT1G67490)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460190.1)
• Pfam: Glycosyl hydrolase family 63 C-terminal domain (PF03200.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;