| Transcript | Ll_transcript_195813 |
|---|---|
| CDS coordinates | 1-345 (+) |
| Peptide sequence | LWKREGDRSVWEYPFAVAGVNITFMLIQMLDLEAVKPRTLVAAAFLKFLEENESAFDLLYCITFMLMDHQWLSMHASYMDFNTVMKSTRSHLEKELLVEDITRLEDLPSYKLLS* |
| ORF Type | 5prime_partial |
| Blastp | ELMO domain-containing protein C from Dictyostelium with 34.78% of identity |
|---|---|
| Blastx | ELMO domain-containing protein C from Dictyostelium with 34.78% of identity |
| Eggnog | ELMO CED-12 domain containing(ENOG410XRXC) |
| Kegg | Link to kegg annotations (DDB_G0282949) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019464704.1) |
| Pfam | ELMO/CED-12 family (PF04727.12) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer