Protein coding transcript 179866

• Transcript: Ll_transcript_196350
• CDS coordinates: 56-682 (+)
• Peptide sequence: MSQLLRLLSEEFDDDYSQRSDQELALSEAVDAMEAIETILASSAMAFVKEQESNKEETQSKESSWDKWKRGGIIGAAALTGGALMAITGGLAAPAIAAGLGALAPTLGTLIPVIGAGGFAAAASAAGTVAGSVAVAASFGAAGAGLTGSKMARRVGSVDEFEFKPIGENHNQGILAVEILVSGFVFEEEDFIRPWEGHNDNLERYCQF*
• ORF Type: complete

Annotations of Ll_transcript_196350

• Blastp: Transmembrane and coiled-coil domain-containing protein 4 from Mus with 39.58% of identity
• Blastx: -
• Eggnog: transmembrane and coiled-coil(ENOG410YB1Z)
• Kegg: Link to kegg annotations (77056)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444802.1)
• Pfam: Protein of unknown function (DUF726) (PF05277.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;