Protein coding transcript 179867

• Transcript: Ll_transcript_196353
• CDS coordinates: 80-520 (+)
• Peptide sequence: MVIVGIAIELMKEGAMLTVLSSLVAALAWPATLITTFDIIDSKWAVAVDRSDKAGKVLAEVLLKGLQGNRPVTLVGFSLGARVIFKCLQCLADSKGDNAGLVERVVILGAPIPIKDENWEAARKVVAGRFVNAYSTDDWTLGITYRA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_196353

• Blastp: Transmembrane and coiled-coil domain-containing protein 4 from Homo with 48.97% of identity
• Blastx: Transmembrane and coiled-coil domain-containing protein 4 from Homo with 47.77% of identity
• Eggnog: transmembrane and coiled-coil(ENOG410YB1Z)
• Kegg: Link to kegg annotations (255104)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416053.1)
• Pfam: Protein of unknown function (DUF726) (PF05277.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;