Protein coding transcript 179885

• Transcript: Ll_transcript_196372
• CDS coordinates: 190-684 (+)
• Peptide sequence: MVACSAMAFIKEQESNKEEIRPKESKWAKWKRGGIIGAAAITGGTLLAVTGGLAAPAIAAGLGALAPTLGTLIPVIGASGFAAAAGAAGTIAGSVAVAASFGAAGAGLTGSKMARRVGGVDEFEFKPIGENHNQGVSFYSLIFLFNVVFLTVIVLRSLFLPVIV*
• ORF Type: complete

Annotations of Ll_transcript_196372

• Blastp: Uncharacterized membrane protein C6F6.13c from Schizosaccharomyces with 33.33% of identity
• Blastx: -
• Eggnog: -
• Kegg: Link to kegg annotations (SPAC6F6.13c)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020978706.1)
• Pfam: Protein of unknown function (DUF726) (PF05277.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;