Protein coding transcript 1799

• Transcript: Ll_transcript_389626
• CDS coordinates: 3-359 (+)
• Peptide sequence: RTNNTKEITRQADIIISAVGKPNMVRGSWIKPGAVIIDVGINSVEDSNSPQGYRLVGDVCFEEASKVASAVTPVPGGVGPMTIAMLLKNTLISARSTILNNTYGQLQPGESMCIIDWSE
• ORF Type: internal

Annotations of Ll_transcript_389626

• Blastp: Bifunctional protein FolD 4, chloroplastic from Arabidopsis with 81.05% of identity
• Blastx: Bifunctional protein FolD 4, chloroplastic from Arabidopsis with 81.05% of identity
• Eggnog: Catalyzes the oxidation of 5,10- methylenetetrahydrofolate to 5,10-methenyltetrahydrofolate and then the hydrolysis of 5,10-methenyltetrahydrofolate to 10- formyltetrahydrofolate (By similarity)(COG0190)
• Kegg: Link to kegg annotations (AT4G00620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016193794.1)
• Pfam: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain (PF02882.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;