Transcript | Ll_transcript_196642 |
---|---|
CDS coordinates | 1850-2335 (+) |
Peptide sequence | MFLLQISEIISRFERKGYKLVGIKVLTPSKEFAQKHYHDLKERPFFGELCGFLSSGPVIAMVRIYQSLVLGIENKHQMFIINPISPKKLMSQVWEGQGVIVYGRKLIGATDPQKSEPGTIRGDLAVNVGRNQKAKSGPVRLLSIGSNSFWCIFRDKIVITI* |
ORF Type | complete |
Blastp | Nucleoside diphosphate kinase III, chloroplastic/mitochondrial from Arabidopsis with 67.46% of identity |
---|---|
Blastx | Nucleoside diphosphate kinase III, chloroplastic/mitochondrial from Arabidopsis with 67.46% of identity |
Eggnog | Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate (By similarity)(COG0105) |
Kegg | Link to kegg annotations (AT4G11010) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019444629.1) |
Pfam | Nucleoside diphosphate kinase (PF00334.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer