Protein coding transcript 179958

• Transcript: Ll_transcript_196660
• CDS coordinates: 377-961 (+)
• Peptide sequence: MTLIWFVSWLLIFHGIGVYYVMIFLLLFLTAYMLQDQEVHAAELERTFIAIKPDGVQRGLISEIISRFERKGYKLVGIKVLTPSKEFAQKHYHDLKERPFFGELCGFLSSGPVIAMVWEGQGVIVYGRKLIGATDPQKSEPGTIRGDLAVNVGRNIIHGSDGPETAKDEIKLWFKPEELVNYTSNAEKWIYGAN*
• ORF Type: complete

Annotations of Ll_transcript_196660

• Blastp: Nucleoside diphosphate kinase IV, chloroplastic/mitochondrial from Arabidopsis with 84.57% of identity
• Blastx: Nucleoside diphosphate kinase III, chloroplastic/mitochondrial from Arabidopsis with 84% of identity
• Eggnog: Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate (By similarity)(COG0105)
• Kegg: Link to kegg annotations (AT4G23900)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444631.1)
• Pfam: Nucleoside diphosphate kinase (PF00334.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;