Protein coding transcript 179967

• Transcript: Ll_transcript_196656
• CDS coordinates: 333-1013 (+)
• Peptide sequence: MDLIIYLILQMIKEAIVSLKERTGSSQYAITKFVEEKHNLLPQNFRKFLLFNLKKLVASGKLVKVKGSFKIPSTPKTKPEPAKPKPKSVSKPASKAPAKAKLAAKPKPKPKPKAPVSKSKAVAAKPKPAVAKPKAAVAKPKAVAAAKPKAVAAKPKAAAKTKVVAVKPKAKATRTSTRTSPGKKVTAVKPAVKKAAALKKAPVKSVKPKSVKSPAKRVGAKRNGRK*
• ORF Type: complete

Annotations of Ll_transcript_196656

• Blastp: Histone H1.2 from Arabidopsis with 49.58% of identity
• Blastx: Histone H1 from Pisum with 74.58% of identity
• Eggnog: histone h1(ENOG410XYG5)
• Kegg: Link to kegg annotations (AT2G30620)
• CantataDB: Link to cantataDB annotations (CNT0002614)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441921.1)
• Pfam: linker histone H1 and H5 family (PF00538.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;