Transcript | Ll_transcript_197424 |
---|---|
CDS coordinates | 1782-2300 (+) |
Peptide sequence | MVKHMPPASVMTRLILIMVWRKLIRNPNTYSSLIGLIWSLVAFRWHVHMPKLIEKSIAILSDAGLGMAMFSLGLFMALQPKMIACGNSVATFAMAVRFLTGPAVMAAASIAVGLRGNLLRIAIVQAALPQGIVPFVFAKEYNVHPAILSTGVIFGMLIALPITLVYYILLGL* |
ORF Type | complete |
Blastp | Auxin efflux carrier component 4 from Arabidopsis with 89.35% of identity |
---|---|
Blastx | Auxin efflux carrier component 3 from Arabidopsis with 73.54% of identity |
Eggnog | auxin efflux carrier(ENOG410Y9XE) |
Kegg | Link to kegg annotations (AT2G01420) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (NP_001316762.1) |
Pfam | Membrane transport protein (PF03547.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer