Protein coding transcript 180

• Transcript: Ll_transcript_499499
• CDS coordinates: 2-307 (+)
• Peptide sequence: SAEKAKRELDGSMFKNRNIKVRFAPLGAAVKVKNLTNHVTNELLETAFSVFGEVERAIVFVDDRGNSLKEGLVEFTRKIGATSALRFCAEGCFFLTSVLKPV
• ORF Type: internal

Annotations of Ll_transcript_499499

• Blastp: Hrp65 protein from Chironomus with 58.42% of identity
• Blastx: Hrp65 protein from Chironomus with 58.42% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015942532.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;