Protein coding transcript 180063

• Transcript: Ll_transcript_195399
• CDS coordinates: 452-1141 (+)
• Peptide sequence: MGFDGNGVDAEIDTESVLYISNLHSEVTNYDIKLLFSEVGDLKRYCIHYDKNGKSKGTAEVVFARRSDALAAIKKYNNMKLDGKPLQIELVGTSSVTPPVIPPFQSSVLGPIPNDGRVRLSSFSGLVTPDVMPPFQSSLLGPIPNDGRRRFHNGFAHGRLPRGPGEGKALTRKVSARDLDEDLERYRRFSKGNGQAKGHAGKVSARDLDDDLERYHSQAMQIKNKENEK*
• ORF Type: complete

Annotations of Ll_transcript_195399

• Blastp: THO complex subunit 4A from Arabidopsis with 63.64% of identity
• Blastx: THO complex subunit 4B from Arabidopsis with 58.88% of identity
• Eggnog: Polymerase (DNA-directed), delta interacting protein 3(ENOG4111JAW)
• Kegg: Link to kegg annotations (AT5G59950)
• CantataDB: Link to cantataDB annotations (CNT0001769)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451709.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF13893.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;