Protein coding transcript 180085

• Transcript: Ll_transcript_195945
• CDS coordinates: 1461-2066 (-)
• Peptide sequence: LPPSSPSLQPSSPPLQPSSPSLPQPSSPPLPPSSPALPPSSPPPAPPSPPQQQEKQLPNIFMERITELNGSDVKFLMHKKLCLSDVKQNNNRLSMPRSQIACEFLTEDEHEKLNERKDDPTRRLIGMEITVMDPFLREYKMTLKKWEMKKNPEDDEMKGVIYNLVTNWYTMVTDNKFKKYQELDIWSFRVDGKLYLLLNDV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_195945

• Blastp: B3 domain-containing protein At2g24670 from Arabidopsis with 30.53% of identity
• Blastx: B3 domain-containing protein At2g24670 from Arabidopsis with 34.31% of identity
• Eggnog: Has 61 Blast hits to 61 proteins in 2 species Archae - 0(ENOG41104NM)
• Kegg: Link to kegg annotations (AT2G24670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447308.1)
• Pfam: Domain of unknown function (DUF313) (PF03754.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;