Transcript | Ll_transcript_195953 |
---|---|
CDS coordinates | 1310-1915 (-) |
Peptide sequence | LPPSSPSLQPSSPPLQPSSPSLPQPSSPPLPPSSPALPPSSPPPAPPSPPQQQEKQLPNIFMERITELNGSDVKFLMHKKLCLSDVKQNNNRLSMPRSQIACEFLTEDEHEKLNERKDDPTRRLIGMEITVMDPFLREYKMTLKKWEMKKNPEDDEMKGVIYNLVTNWYTMVTDNKFKKYQELDIWSFRVDGKLYLLLNDV* |
ORF Type | 5prime_partial |
Blastp | B3 domain-containing protein At2g24670 from Arabidopsis with 30.53% of identity |
---|---|
Blastx | B3 domain-containing protein At2g24670 from Arabidopsis with 34.31% of identity |
Eggnog | Has 61 Blast hits to 61 proteins in 2 species Archae - 0(ENOG41104NM) |
Kegg | Link to kegg annotations (AT2G24670) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447308.1) |
Pfam | Domain of unknown function (DUF313) (PF03754.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer