Protein coding transcript 180130

• Transcript: Ll_transcript_196138
• CDS coordinates: 1-627 (+)
• Peptide sequence: SGTPLHPETTSSVYIYELFNEDLRSPPVSEANWGLFYVNTTPTYLLHLSEIGTFLANDTTNQTYCIATDDADSKTLQAALDWTCGPGRANCSEIQPGESCYQPNNVKNHASYAFDSYYQTQGKGPGACDFKGIAMITTSDPSHRSCIFPGSKQLTKQTKQVVNSTQSSNAGEKLRLRLRIFSSIKISAISNILHIHLVAVVPSILFVL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_196138

• Blastp: Glucan endo-1,3-beta-glucosidase 1 from Arabidopsis with 77.33% of identity
• Blastx: Glucan endo-1,3-beta-glucosidase 1 from Arabidopsis with 77.33% of identity
• Eggnog: glucan endo-1-3-beta-glucosidase(ENOG410YEGG)
• Kegg: Link to kegg annotations (AT1G11820)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419721.1)
• Pfam: Glycosyl hydrolases family 17 (PF00332.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;