Protein coding transcript 18016

• Transcript: Ll_transcript_355679
• CDS coordinates: 2-364 (+)
• Peptide sequence: PTRTQQEQLQHWQKNRRMLAYSTVGTPDYIAPEVLLKKGYGLECDWWSLGAIMYEMLVGYPPFYSDEPMLTCRKIVNWKTYLKFPEEAKLSAEAKNLICRLLCNVEQRLGTKGAHEIKAHP
• ORF Type: internal

Annotations of Ll_transcript_355679

• Blastp: Serine/threonine-protein kinase CBK1 from Pneumocystis with 58.33% of identity
• Blastx: Serine/threonine-protein kinase CBK1 from Pneumocystis with 58.33% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413779.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;