Transcript | Ll_transcript_355679 |
---|---|
CDS coordinates | 2-364 (+) |
Peptide sequence | PTRTQQEQLQHWQKNRRMLAYSTVGTPDYIAPEVLLKKGYGLECDWWSLGAIMYEMLVGYPPFYSDEPMLTCRKIVNWKTYLKFPEEAKLSAEAKNLICRLLCNVEQRLGTKGAHEIKAHP |
ORF Type | internal |
Blastp | Serine/threonine-protein kinase CBK1 from Pneumocystis with 58.33% of identity |
---|---|
Blastx | Serine/threonine-protein kinase CBK1 from Pneumocystis with 58.33% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413779.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer