Protein coding transcript 18019

• Transcript: Ll_transcript_355667
• CDS coordinates: 229-762 (+)
• Peptide sequence: MYEMLVGFPPFYSDEPMSTCKKIVNWKTYLKFPEEAKLSAEAKDLICRLLCNVEQRLGTKGAHEIKAHPWFKGIEWDKLYQMKAAFIPEVNDELDTQNFEKFDEVEKKTEPSTKAGPWKKMLPSKDVNFVGYTYKNFEILNDHEIHGIGMHLYLSIYYSSAVITIIFYIILLSVSLC*
• ORF Type: complete

Annotations of Ll_transcript_355667

• Blastp: Serine/threonine-protein kinase CBK1 from Pneumocystis with 42.57% of identity
• Blastx: Serine/threonine-protein kinase CBK1 from Pneumocystis with 44.81% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449952.1)
• Pfam: Protein kinase C terminal domain (PF00433.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;