Transcript | Ll_transcript_197252 |
---|---|
CDS coordinates | 933-1787 (+) |
Peptide sequence | MPEMDNTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPQSKVACETCTKTNMVMVFGEITTKANVNYEKIVRDTCRGIGFVSADVGLDADKCNVLVNIEQQSPDIAQGVHGHMTKAPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNDKGAMVPIRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRS |
ORF Type | 3prime_partial |
Blastp | S-adenosylmethionine synthase 2 from Populus with 96.42% of identity |
---|---|
Blastx | S-adenosylmethionine synthase 2 from Populus with 96.42% of identity |
Eggnog | Catalyzes the formation of S-adenosylmethionine from methionine and ATP(COG0192) |
Kegg | Link to kegg annotations (POPTR_0013s00550g) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019414807.1) |
Pfam | S-adenosylmethionine synthetase, N-terminal domain (PF00438.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer