Protein coding transcript 180265

• Transcript: Ll_transcript_197253
• CDS coordinates: 66-518 (+)
• Peptide sequence: METFLFTSESVNEGHPDKICDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKANVNYEKIVRDTCRGIGFVSADVGLDADKCNVLVNIEQQSPDIAQGVHGHMTKAPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_197253

• Blastp: S-adenosylmethionine synthase 1 from Vitis with 95.36% of identity
• Blastx: S-adenosylmethionine synthase 1 from Vitis with 95.36% of identity
• Eggnog: Catalyzes the formation of S-adenosylmethionine from methionine and ATP(COG0192)
• Kegg: Link to kegg annotations (100263678)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003541415.1)
• Pfam: S-adenosylmethionine synthetase, N-terminal domain (PF00438.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;