Protein coding transcript 180268

• Transcript: Ll_transcript_197262
• CDS coordinates: 2-643 (+)
• Peptide sequence: VRETCRNIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNDKGAMVPIRVHTVLISTQHDETVTNDGIAADLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDQTKVDRSG
• ORF Type: internal

Annotations of Ll_transcript_197262

• Blastp: S-adenosylmethionine synthase 2 from Catharanthus with 97.2% of identity
• Blastx: S-adenosylmethionine synthase 2 from Catharanthus with 97.2% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020223541.1)
• Pfam: S-adenosylmethionine synthetase, central domain (PF02772.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;