Protein coding transcript 180269

• Transcript: Ll_transcript_197263
• CDS coordinates: 66-500 (+)
• Peptide sequence: METFLFTSESVNEGHPDKICDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKANVNYEKIVRDTCRGIGFISPDVGLDADNCKVLVNIEQQSPDIAQGVHGHMTKKPEDIGAGDQGHMFGYATDETPELMPLTHVLA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_197263

• Blastp: S-adenosylmethionine synthase 3 from Catharanthus with 96.55% of identity
• Blastx: S-adenosylmethionine synthase 3 from Catharanthus with 96.55% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443081.1)
• Pfam: S-adenosylmethionine synthetase, N-terminal domain (PF00438.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;