Protein coding transcript 180271

• Transcript: Ll_transcript_197237
• CDS coordinates: 1-624 (+)
• Peptide sequence: VPLRVHTVLISTQHDETVTNDQIAKDLKEHVIKPVIPAEYLDDKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCIVQVSYAIGVPEPLSVFVDTYKTGKIPDKDILALIKENFDFRPGMIAINLDLTRGGNFRYQKTAAYGHFGRDDPDFTWETVKMLKPKA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_197237

• Blastp: S-adenosylmethionine synthase 2 from Nicotiana with 92.75% of identity
• Blastx: S-adenosylmethionine synthase 2 from Actinidia with 95.17% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107807060)
• CantataDB: Link to cantataDB annotations (CNT0001925)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443081.1)
• Pfam: S-adenosylmethionine synthetase, central domain (PF02772.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;