Protein coding transcript 180272

• Transcript: Ll_transcript_197243
• CDS coordinates: 1-633 (+)
• Peptide sequence: VPLRVHTVLISTQHDETVTNDQIAKDLKEHVIKPVIPAEYLDDKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMISINLDLKRGGNKRFLKTAAYGHFGRDDTDFTWEVVKPLKWDKVAA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_197243

• Blastp: S-adenosylmethionine synthase from Gossypium with 94.29% of identity
• Blastx: S-adenosylmethionine synthase from Gossypium with 94.29% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0001925)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417328.1)
• Pfam: S-adenosylmethionine synthetase, central domain (PF02772.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;