Protein coding transcript 180274

• Transcript: Ll_transcript_197245
• CDS coordinates: 237-605 (+)
• Peptide sequence: MPEMDNTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPQSKVACETCTKTNMVMVFGEITTKANVDYEKIVRNTCRGIGFTSADVGLDADNCKVLVNIEQQSPDIAQGVHGHMTKKPEEIG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_197245

• Blastp: S-adenosylmethionine synthase 1 from Nicotiana with 96.58% of identity
• Blastx: S-adenosylmethionine synthase 1 from Nicotiana with 96.58% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107785513)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459571.1)
• Pfam: S-adenosylmethionine synthetase, N-terminal domain (PF00438.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;