Transcript | Ll_transcript_197246 |
---|---|
CDS coordinates | 3-908 (+) |
Peptide sequence | LPSSIFFILLLPSHKLLKMAAETFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNLVMVFGEITTKANIDYEKIVRNTCRNIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEDIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNDKGAMVPIRVHTVLISTQHDETVTNDGIAADLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDQTKVDRSG |
ORF Type | internal |
Blastp | S-adenosylmethionine synthase from Medicago with 95.77% of identity |
---|---|
Blastx | S-adenosylmethionine synthase from Medicago with 95.77% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463337.1) |
Pfam | S-adenosylmethionine synthetase, N-terminal domain (PF00438.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer