Protein coding transcript 180277

• Transcript: Ll_transcript_197250
• CDS coordinates: 3-905 (+)
• Peptide sequence: LPSSIFFILLLPSHKLLKMAAETFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNLVMVFGEITTKANIDYEKIVRNTCRNIGFVSDDVGLDADNCNVLVNIEQQSPDIAQGVHGHLTKKPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNDKGAMVPIRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIATYGGWGAHGGGAFSGKDPTKVDRS
• ORF Type: internal

Annotations of Ll_transcript_197250

• Blastp: S-adenosylmethionine synthase from Medicago with 95.76% of identity
• Blastx: S-adenosylmethionine synthase from Medicago with 95.76% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463337.1)
• Pfam: S-adenosylmethionine synthetase, N-terminal domain (PF00438.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;