Protein coding transcript 180280

• Transcript: Ll_transcript_195493
• CDS coordinates: 366-782 (+)
• Peptide sequence: MGLLAVFCTNSINIHAGLNGLEVGQTVVIASAILIHNIMQIGASTDPEYKQAHAFSVYLTQPLLGTSLALLSYNWYPSSVFVGDTFTYFAGMTMAVIGILGHFSETLLIFFLPQVLNFLLSLPQLSGYIPCPRHRLPK*
• ORF Type: complete

Annotations of Ll_transcript_195493

• Blastp: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase from Bos with 62.32% of identity
• Blastx: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase from Bos with 52.28% of identity
• Eggnog: phospho-N-acetylmuramoyl-pentapeptide-transferase activity(COG0472)
• Kegg: Link to kegg annotations (537812)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016183525.1)
• Pfam: Glycosyl transferase family 4 (PF00953.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;